Verwendung: Dieses Produkt ist ausschließlich für Forschungszwecke bestimmt.
Alle Produktinformationen auf dieser Website dienen ausschließlich Bildungszwecken. Jede Form der Einbringung in den Körper von Menschen oder Tieren ist gesetzlich streng verboten. Dieses Produkt darf nur von zugelassenen und qualifizierten Fachleuten gehandhabt werden. Es ist kein Arzneimittel, Lebensmittel oder Kosmetikum und darf nicht als solches gekennzeichnet, verwendet oder falsch etikettiert werden.
6mg in a Vial
Während der Umstellung unserer Verpackung erhalten Sie möglicherweise Produkte mit dem bisherigen oder dem neuen Etikett. Formulierung, Reinheit und Qualität bleiben nach unseren Standards genau gleich.
-25% auf alles – bis 31. Oktober
25% auf reguläre Preise statt anderer Angebote. Nur mit dem Krypto-Zahlungsrabatt kombinierbar.
Jede Charge wird auf Reinheit, Wirksamkeit und Qualität geprüft.
Laborergebnisse ansehen →6mg in a Vial
| CAS Number | 154947-66-7 |
|---|---|
| Appearance | Lyophilized Powder |
| Chemical Names | CAMP, IPR001894, CAP-18, CAP18, CRAMP, HSD26, gene FALL39, gene LL37, FALL39, LL37, FALL-39, cathelicidin antimicrobial peptide, Cathelicidins, Cathelicidin, LL-37, 154947-66-7, Ropocamptide, Bac4, All38 peptide, Cathelicidin LL 37, LL-37 (Human), hCAP 18, UNII-3DD771JO2H, LL-37 trifluoroacetate salt, LL-37/hCAP18, 3DD771JO2H, CHEMBL530345, LL 37, Cathelicidin antimicrobial peptide 18, AKOS024458536 |
| Molecular Formula | C205H340N60O53 |
| Sequence | [LL-37, 37 aa] |
| Molecular Weight | 4493 g/mol |
Never received my order. Contacted support and explained the situation and seemed to be helpful initially until I never received my tracking numbers! Followed it up with them and they have been unresponsive. Finally received a response with tracking numbers and hopefully it will be a seamless transaction moving forwards.
Wow Oder came as planned, I was able track it the entire way and made me feel comfortable about my order!
i am extremely happy with the delivery rate and the product!
The research results have been great so far. Super happy with the ordering process and purity is outstanding. Thanks for the outstanding support!
Highly consistent test results. First-class experience with the ordering process and purity is outstanding. I will definitely be back.
Outstanding experience with the ordering process and purity exceeded my expectations. Our research results are completely exceeding expectations. Great value.
We got fantastic research results. Cannot recommend enough the fast turnaround times, the compound is pure and high quality. Highly recommend this vendor.
