Utilisation : Ce produit est destiné uniquement à la recherche.
Toutes les informations sur les produits présentes sur ce site sont fournies à titre éducatif uniquement. Toute forme d’introduction dans le corps humain ou animal est strictement interdite par la loi. Ce produit doit être manipulé uniquement par des professionnels agréés et qualifiés. Il ne s’agit pas d’un médicament, d’un aliment ou d’un cosmétique et il ne doit pas être présenté, utilisé ou étiqueté comme tel.
6mg in a Vial
Pendant notre changement d’emballage, vous pouvez recevoir des produits avec l’ancienne ou la nouvelle étiquette. La formulation, la pureté et la qualité restent exactement les mêmes, selon nos standards.
-25% sur tout – jusqu’au 31 octobre
25% sur les prix habituels, en remplacement des autres soldes. Cumulable uniquement avec la remise crypto.
Expédition le jour même pour les commandes aux États-Unis passées avant 12 h EST.
Voir la politique de livraison →Chaque lot est testé pour sa pureté, sa puissance et sa qualité.
Voir les résultats d’analyse →6mg in a Vial
| CAS Number | 154947-66-7 |
|---|---|
| Appearance | Lyophilized Powder |
| Chemical Names | CAMP, IPR001894, CAP-18, CAP18, CRAMP, HSD26, gene FALL39, gene LL37, FALL39, LL37, FALL-39, cathelicidin antimicrobial peptide, Cathelicidins, Cathelicidin, LL-37, 154947-66-7, Ropocamptide, Bac4, All38 peptide, Cathelicidin LL 37, LL-37 (Human), hCAP 18, UNII-3DD771JO2H, LL-37 trifluoroacetate salt, LL-37/hCAP18, 3DD771JO2H, CHEMBL530345, LL 37, Cathelicidin antimicrobial peptide 18, AKOS024458536 |
| Molecular Formula | C205H340N60O53 |
| Sequence | [LL-37, 37 aa] |
| Molecular Weight | 4493 g/mol |
Never received my order. Contacted support and explained the situation and seemed to be helpful initially until I never received my tracking numbers! Followed it up with them and they have been unresponsive. Finally received a response with tracking numbers and hopefully it will be a seamless transaction moving forwards.
Wow Oder came as planned, I was able track it the entire way and made me feel comfortable about my order!
i am extremely happy with the delivery rate and the product!
The research results have been great so far. Super happy with the ordering process and purity is outstanding. Thanks for the outstanding support!
Highly consistent test results. First-class experience with the ordering process and purity is outstanding. I will definitely be back.
Outstanding experience with the ordering process and purity exceeded my expectations. Our research results are completely exceeding expectations. Great value.
We got fantastic research results. Cannot recommend enough the fast turnaround times, the compound is pure and high quality. Highly recommend this vendor.
