★★★★★
★★★★★
Verified Buyer
It was my first time ordering from this company and the process was quick and easy.
Product Usage: This product is intended for research purposes only.
All product information available on this website is for educational purposes only. Any form of bodily introduction into humans or animals is strictly prohibited by law. This product should only be handled by licensed and qualified professionals. It is not a drug, food, or cosmetic, and must not be misbranded, misused, or mislabeled as such.
99% Purity Guaranteed
Research Use Only
Secure Checkout
GLP-2 (Teduglutide / GLP-2 Analogue 5mg Lyophilized Vial)
GLP-2 (Glucagon-Like Peptide-2) 5mg lyophilized peptide standard for intestinal mucosal, crypt cell, and gastrointestinal barrier research.
Same Trusted Formula. Fresh New Look.
During our packaging transition, you may receive products with either our previous or updated label. Rest assured, the formulation, purity and quality remain exactly the same as per our standards.
Accepted Payment Methods
- Credit card
- Bank transfer (instant SEPA)
- Bank transfer (ACH)
- Wise
- Revolut
- Zelle
- Remitly
- Western Union
- Chime
- Others
-25% on everything – until October 31
25% off regular prices, replacing other product sales. Only the crypto payment discount can be combined.
Overview
Peptide Monograph: GLP-2 (33 Amino Acids)
Glucagon-Like Peptide-2 (GLP-2) is a 33-amino-acid peptide co-secreted with GLP-1 from intestinal L-cells. It selectively activates the GLP-2 receptor in enteric neurons and subepithelial myofibroblasts, promoting mucosal growth, crypt cell proliferation, and mesenteric blood flow.
Properties
- Sequence: HADGSFSDEMNTILDNLAARDFINWLIQTKITD
- Molecular Weight: 3752.1 g/mol
- Purity: ≥98.0% HPLC
- Format: 5mg Lyophilized Cake in 3ml sterile vial
- Reconstitution: Reconstitute with 1.0ml sterile bacteriostatic water.
- Storage: Store at -20°C. Protect from moisture and light.
Customer Reviews (8)
★★★★★
★★★★★
5 / 5
★★★★★
★★★★★
Verified Buyer
The quality is excellent, and the delivery was prompt.
★★★★★
★★★★★
Verified Buyer
Surpasses all competitors—best product ever.
★★★★★
★★★★★
Verified Buyer
Finally a place to trust. Definitely a bi-weekly customer here.
★★★★★
★★★★★
Verified Buyer
Fast shipping , great value. My current source and a good one. Reliable shipping, I never have to track rest assured it will show up in my mailbox in 2 to 3 days.
★★★★★
★★★★★
Verified Buyer
Exceptional service on the super fast shipping, quality is stellar. I will definitely be back. Results from my tests exceeded all expectations.
★★★★★
★★★★★
Verified Buyer
Highly satisfied with the fast turnaround times, it's an exceptionally pure batch. My laboratory research results exceeded expectations. Excellent all-round service.
★★★★★
★★★★★
Verified Buyer
Top-notch quality from the support team and the quality is absolutely top-tier. Our research results are completely exceeding expectations. Thanks for the outstanding support!
